PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013608183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 576aa    MW: 64260.4 Da    PI: 6.9846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013608183.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.67.1e-142875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ede+l  +v++ G g+W+++ +  g+ R++k+c++rw ++l
   XP_013608183.1 28 KGPWTAAEDEILSVYVRENGEGNWNAVQKNTGLVRCGKSCRLRWANHL 75
                     79******************************99**********9986 PP

2Myb_DNA-binding46.39.8e-1581124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T +E+ l++++++qlG++ W++ a+ ++ gRt++++k++w++
   XP_013608183.1  81 KGSFTGDEERLIIQLHAQLGNK-WARMAAQLP-GRTDNEIKNYWNT 124
                      789*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4832375IPR017930Myb domain
SMARTSM007173.0E-122777IPR001005SANT/Myb domain
SuperFamilySSF466892.66E-2727122IPR009057Homeodomain-like
PfamPF002491.3E-122875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-202982IPR009057Homeodomain-like
CDDcd001671.88E-93075No hitNo description
PROSITE profilePS5129424.3276130IPR017930Myb domain
SMARTSM007175.6E-1580128IPR001005SANT/Myb domain
PfamPF002491.9E-1381124IPR001005SANT/Myb domain
CDDcd001679.50E-1183126No hitNo description
Gene3DG3DSA:1.10.10.608.6E-2483128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009860Biological Processpollen tube growth
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MIMYGGEIEK AGGSANHMSN GGGVVLKKGP WTAAEDEILS VYVRENGEGN WNAVQKNTGL  60
VRCGKSCRLR WANHLRPNLR KGSFTGDEER LIIQLHAQLG NKWARMAAQL PGRTDNEIKN  120
YWNTRLKRLQ RQGLPLYPPD IIPNHQLHPH PHHHQQNHHH QQHQHQQMYF QQQSSQPNTP  180
SSSPLPSPTP INANPSSSFT FHSTNASTAY LLHPLSPHTP TTPQTPSQLS STPPPPPLSS  240
PLSSPRNNQY PTLPLFTFPS SQINNNNNNT NFTFPRPPPL LQPPSSLLAK RYNNSNTPLN  300
CINRVSTAPF SPVSRDSYTS FLTLPYSSPT AQTATYHNTN NNYSSFSLNP SPSSYPTTTS  360
SPSFLHSQYT PNYSSTSFHN NPVYSMKQEF PSNQIPQIGV FNNVNNFTDN EKQNNTNLHR  420
RSISCSLLED VLVEAEALAG GDGDRPSKRR QLTASPPNHH NNNNNDNDNF FSVSFEQYDS  480
SENICSLQDL KPKEEESLQM NTMQDDIAKL LDWGSDSGEI SNGQSSVLTD DNLVLDVHQL  540
NSLFPADSTA AETRTNDEQN NNDKINCSWD NLHGVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-28251281103C-Myb DNA-Binding Domain
1msf_C6e-28251281103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608183.10.0PREDICTED: transcription factor MYB26-like
TrEMBLA0A0D3EB750.0A0A0D3EB75_BRAOL; Uncharacterized protein
STRINGBra002938.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM99391934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55020.11e-83myb domain protein 120